PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G289700.1
Common NamePHAVU_003G289700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ZF-HD
Protein Properties Length: 220aa    MW: 23628.6 Da    PI: 9.1186
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G289700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.72.1e-312782359
         ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                        k +YkeClkNhA+ +Ggha+DGCgEfm++ g+egt +alkCaAC+CHRnFHR++++e
  Phvul.003G289700.1 27 KGNYKECLKNHAVGIGGHALDGCGEFMAA-GAEGTLDALKCAACNCHRNFHRKDPAE 82
                        568*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-222879IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.5E-292979IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.6E-282979IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.2073079IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.72E-20143217IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-30148218IPR009057Homeodomain-like
TIGRFAMsTIGR015653.5E-25156212IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MDFEDQPFNP LPPPPTPPPT TNPNTAKGNY KECLKNHAVG IGGHALDGCG EFMAAGAEGT  60
LDALKCAACN CHRNFHRKDP AESSFQLRRH RAPQFAAAFY RAPAGYLQVA GPQRGGLATL  120
ALPSTSGAGG GAQSPGEEQE NVSEPSGGGG GCGSHKKRFR TKFSLEQKDK MLAFAEKLGW  180
RIQKHDESLV QEFCSQTGLQ RHVLKVWMHN NKHTLGKKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-271572141875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156483.11e-163hypothetical protein PHAVU_003G289700g
SwissprotA2Z2591e-69ZHD1_ORYSI; Zinc-finger homeodomain protein 1
SwissprotQ6YXH52e-69ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLV7CE501e-163V7CE50_PHAVU; Uncharacterized protein
STRINGGLYMA18G21520.22e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.13e-65homeobox protein 22